PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00016755-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MYB_related
Protein Properties Length: 345aa    MW: 37570.1 Da    PI: 7.0704
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00016755-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding391.9e-12103147347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE+ +++ + ++lG+g+W+ Iar +   Rt+ q+ s+ qky
  WALNUT_00016755-RA 103 PWTEEEHRQFLIGLNKLGKGDWRGIARNFVISRTPTQVASHAQKY 147
                         8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.515320IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129419.86796152IPR017930Myb domain
SuperFamilySSF466896.8E-1798153IPR009057Homeodomain-like
TIGRFAMsTIGR015578.4E-1899151IPR006447Myb domain, plants
SMARTSM007173.5E-10100150IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.3E-11100146IPR009057Homeodomain-like
CDDcd001676.67E-9103148No hitNo description
PfamPF002491.1E-10103147IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNSRTCPN RGGGGCVKLF GVKLTDGSII KKSASMGNLS AHYHSSSSAA  60
ASPNHLDSPS SDLVHVSDGY LSDDPAHASC SANRRGDRKK GVPWTEEEHR QFLIGLNKLG  120
KGDWRGIARN FVISRTPTQV ASHAQKYFIR QTNANRKKRR SSLFDMVQDM ATETPPAPED  180
QILLPSAQTR ETDIAMSLPS LNLTLKSEFE PMEATPEEKV QEHDESEGSS GLAPMIPGFF  240
PAYLPLHFPI WPPNTAPVEE EKGGETSHHQ VLKPTPILPK EPVNVDELFG MSQLSLVEAE  300
RSHREPSPLS LKLIGGPSRQ SAFHANAPVS GSDLNKGESS VIESV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015902398.11e-177PREDICTED: uncharacterized protein LOC107435329
RefseqXP_015902404.11e-177PREDICTED: uncharacterized protein LOC107435334
TrEMBLA0A0B2RLB01e-166A0A0B2RLB0_GLYSO; Transcription factor MYB1R1
TrEMBLA0A0R4J5531e-166A0A0R4J553_SOYBN; Uncharacterized protein
STRINGGLYMA13G43120.11e-166(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77193346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.11e-110MYB_related family protein